SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9Q1Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9Q1Y6
Domain Number 1 Region: 150-371
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.5e-63
Family Creatinase/aminopeptidase 0.0000119
Further Details:      
 
Domain Number 2 Region: 9-138
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.00000016
Family Creatinase/prolidase N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9Q1Y6
Sequence length 375
Comment (tr|D9Q1Y6|D9Q1Y6_ACIS3) Xaa-Pro dipeptidase {ECO:0000313|EMBL:ADL19324.1} KW=Complete proteome; Reference proteome OX=666510 OS=345-15). GN=ASAC_0918 OC=Acidilobus.
Sequence
MEARWDLNRRKLRDLLDRESVDALLLLGAPNITYATGIREPTGAMLITRDCGDVILTSVL
DYNRVSSMSPKDVAVKAFYRRSGEASVGMAMVPQSDLISGGLTDAVKQVLGNCNVKSIGA
DLQWADYASLNVAQQLQARDLSSSIAKVRAIKDDWEVQAILDSIAAAEQAFREAIELLDS
SPSESEVEAAFYSSLMRQGAWGESFPTIVAFYDHTALPHHTPTPVRLQKPGPVLIDFGAD
MYGYASDTTRSMWHGEGGAEYKRLIELVAEAQAAAVDQIAPGVEARSPDLASRRVLAKEG
LDKFYNHGLGHGVGVEVHEVPYLAPASTDVLEKNMVVTVEPGFYIPGVYGVRVEDMVLVT
AKGARLLTRLSRIIS
Download sequence
Identical sequences D9Q1Y6
gi|302348717|ref|YP_003816355.1| WP_013266836.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]