SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9QFT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9QFT5
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily YccV-like 5.49e-16
Family YccV-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9QFT5
Sequence length 104
Comment (tr|D9QFT5|D9QFT5_BRESC) Hemimethylated DNA binding protein {ECO:0000313|EMBL:ADL00649.1} KW=Complete proteome; Reference proteome OX=633149 OS=/ NBRC 16000 / CB 81) (Caulobacter subvibrioides). GN=Bresu_1337 OC=Caulobacteraceae; Brevundimonas.
Sequence
MTQSLTAKFGLGQIVRHREDSFRGVVVDVDATYAGPSNEPGPDHRDQPFYRVLAMGEDTG
FLVYAAEAVLEHDPDVAPLTDADQAQWFTMDDAGHRAPRAQPIH
Download sequence
Identical sequences D9QFT5
WP_013268752.1.28618 gi|302382449|ref|YP_003818272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]