SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SD53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SD53
Domain Number 1 Region: 15-147
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.5e-28
Family CAC2371-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SD53
Sequence length 209
Comment (tr|D9SD53|D9SD53_GALCS) Methyltransferase type 11 {ECO:0000313|EMBL:ADL56651.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_2655 OC=Gallionellaceae; Gallionella.
Sequence
MTSDYRCNPLLRLSYSLIAPVYDLVIERPMRAARKRSLAALPAGASRHVLVSGIGTGLDL
PHLPTQHHYTALDFNAAMLARARPRGEKLDVEFVLGDSMALPFAGNHFDHVVLHLITAVV
PDPASCLSEAARVLKPGGTIILFDKFLRAGKAAPLRRLLTPLSGRIATRMDVVFEKVLLA
VPELEIISDEPMMARGWFRGIILTKKGLL
Download sequence
Identical sequences D9SD53
WP_013294570.1.12990 gi|302879851|ref|YP_003848415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]