SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SDY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SDY9
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000737
Family rRNA methyltransferase RlmA 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9SDY9
Sequence length 197
Comment (tr|D9SDY9|D9SDY9_GALCS) Uncharacterized protein {ECO:0000313|EMBL:ADL56811.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_2818 OC=Gallionellaceae; Gallionella.
Sequence
MNHLDLGCGTNPQNPYKRANLFGLDIRDDAEQVLALRGISMKKANLVFEAIPFSDNYFSS
ISAIDFLEHIPRQICLGSSNELVYPFINIMNEVWRVLTPGGKFLAVTPAYPSSLAFADPT
HVNYLAQGTHEYFCGEHPAGRIYGFHGRFVARIAKLSAPTNYRDMPHSPFASAIRDLGRR
ISRNGLHHMVWELEAIK
Download sequence
Identical sequences D9SDY9
gi|302880011|ref|YP_003848575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]