SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SE53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SE53
Domain Number 1 Region: 71-290
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.29e-40
Family Ribosomal protein L11 methyltransferase PrmA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SE53
Sequence length 297
Comment (tr|D9SE53|D9SE53_GALCS) Ribosomal protein L11 methyltransferase {ECO:0000256|HAMAP-Rule:MF_00735} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_2883 OC=Gallionellaceae; Gallionella.
Sequence
MAWLTLIVDTDAKYAEALSDALLEHGALSVDLLDADADTPDEQAIFGEPGEPPPGVWQHN
RVSALFDADADVAGILSTAAQIVGLTGLPEHRIETLADNDWVRLTQSQFEPIPISNRLWI
VPTWHTAADPDAINIVLDPGLAFGTGSHPTTRLCLRWLDSHLQGGERVLDYGCGSGILAI
AAIKLGAAHAVGVDVDAQAVTASRDNATANDVHEVAFYLPNQAPGGQYDLVVANILTNPL
RLLAPLLAGATRTGGQIVLSGILEAQAQDVMAIYQQWFDLNTPVFEDGWSCLSGRKR
Download sequence
Identical sequences D9SE53
gi|302880075|ref|YP_003848639.1| WP_013294777.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]