SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SEE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SEE3
Domain Number 1 Region: 79-258,308-388,490-665
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.99e-66
Family N-6 DNA Methylase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SEE3
Sequence length 1170
Comment (tr|D9SEE3|D9SEE3_GALCS) Putative restriction enzyme {ECO:0000313|EMBL:ADL54919.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_0887 OC=Gallionellaceae; Gallionella.
Sequence
MNKSKLKSYAPQARRDFIAAVTARANLLGLSDSGGKLEVAIGERKGDIAIIAGQEWPAKV
YELRERLIKRMTTEGFSHTVDAIAYTWFNRFAALRYMEIHDYLDHGYRALSNREGGMPEI
LNHATELDLPGLNKDRAVELKLAGDKDGELYKMLLVAQCNTLSRSMPFLFEHIDDETELL
LPDNLLRTDSVIAKLVAAIPEEDWQEVEIIGWLYQFYISEKKDEVIGKVVKSEDIPAATQ
LFTPNWIVKYLVQNSVGRLWLMANPASTLKSEWAYYIEPAEQTPEVQAQLDALIQTRMIE
DGGSLSPETIKMLDPACGSGHILVEAYEVLKGIYLERGYRLRDIPRLILEKNLFGLDIDD
RAAQLAGFALLMKARADDRRLFDNPPTLNVLALQESKGLDAVQLSAALVGSGQWAVGSKQ
QLSTDVCSLITVFEYAKTFGSLIQIPPSLNMKLATMAESLQQAIKSGDLLSESAAQQLLP
LVEQAKVLGMQFDAVVANPPYMGGKGMNPVLKDYAKATFPDSKSDLFAMFIERGFGWCKP
TGFNSMVTMQSWMFLSSYEAMREKLLTDRTIMTMAHLGARAFSEISGEVVQTTAFILQGK
HFSGFKPVFFRLVDGLEAEKEATLLAGLNRHDLTIQDAFKKIPGSPVAYWVGKKIIDAFS
KNQLIGSRAKKGITTGDNEKFLRYWFEVSIEKLSMLGGNKWFPSQKGGEFKKWYGNLEFI
INWGNSGFEIKNFKTSSGALRSVIRNESYYFLEGVSWTDVSTGKISARYVPDGFLFNASG
PTVFSENPMLFLANLNNVVTYKNTEFICPTIHFEVGQIQRLPFTNIDDTSHVNDLVRMAR
QDWNASEYSWEFEESPLAAKRGNTLKKTWDQWQIACVERVLKTKALEELNNRLFITAYGL
QDELSPEVPEEQITLTRADREKDSQRLISYVIGCIMGRYSLDEPGLIYAHAGNIGFDATR
CQTFPADADGIVPLTDEFWFEDDAANRIREFLLAVWGAETLNENMAWLAESLGMKGNETS
EETIRRYLASSFFKNHLQTYKKRPIYWLFSSGKQGAFQALVYLHRYHEGTLARMRAEYVV
PLTSKIQSRIEMLIKDAEVATVTSVRNKINKEVEVLRKKHVELLAYDEKLRHYADMRIQL
DLDDGVKVNYGKFGDLLAEVKAVTGGSGDE
Download sequence
Identical sequences D9SEE3
gi|302878119|ref|YP_003846683.1| WP_013292860.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]