SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SF50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SF50
Domain Number 1 Region: 10-215
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.18e-39
Family Protein-L-isoaspartyl O-methyltransferase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SF50
Sequence length 220
Comment (tr|D9SF50|D9SF50_GALCS) Protein-beta-aspartate methyltransferase {ECO:0000256|HAMAP-Rule:MF_00090} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_1119 OC=Gallionellaceae; Gallionella.
Sequence
MTMRHSGIGMTSARTRQRMIDRLRDQGIVDEAVLAAMYEVPRHLFVDEALASRAYDDVSL
PINYEQTISQPYIVARMIEVLRASTTRPIKKVLEIGTGCGYQAAVLAHVFPEVYSMERIE
PLYQRAKSKLHDLAINNVKLSYADGSAGLPDAALFDGIIMAAAAPVMLAALREQLAVGGR
MVLPVGRQEQWLYLVEREAQGFRESRLEPVKFVPLLMGKA
Download sequence
Identical sequences D9SF50
gi|302878347|ref|YP_003846911.1| WP_013293087.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]