SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SFV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SFV8
Domain Number 1 Region: 18-199
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-52
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 278-472
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.42e-51
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 213-281
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000772
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.014
Further Details:      
 
Domain Number 4 Region: 833-950
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000242
Family Heme-binding PAS domain 0.064
Further Details:      
 
Domain Number 5 Region: 742-843
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000242
Family PYP-like 0.072
Further Details:      
 
Weak hits

Sequence:  D9SFV8
Domain Number - Region: 586-619,651-738
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0022
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 
Domain Number - Region: 513-625
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0754
Family Heme-binding PAS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SFV8
Sequence length 963
Comment (tr|D9SFV8|D9SFV8_GALCS) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor {ECO:0000313|EMBL:ADL55405.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_1379 OC=Gallionellaceae; Gallionella.
Sequence
MDADPIEPPVPVSPIIPFNVVGMGASAGGLEAFEVFFHHMPPDSGMTFVVISHLYPGHAS
ILTEILQRTTSMRVVEIEDQTQVEPNTVYVIPPNRDLAIFHGILQLSVPVQPHAQRLPID
TFFRSLADDMGARAVGIILSGTGTDGTLGLRAILGAGGVSLVQEPASAKYDGMPQSAIKS
GFASRVLTVESMPAALIKGISIGTVVEPVARTGELNRILMQLRSVTGHDFSQYKKSTIGR
RIERRMSMHDIDSLEVYGRYLKEHPEETGKLFKELLINVTSFFRDAEAFDVLQNEVLPQL
LVDKPDDYVLRIWVAGCATGEEAYSIAMLLSEYMENSHQVFKVLLFATDLDDDAIAVART
GLYPLNIAQDVSAERLRRFFLKEESGFRVKKSIREMVVFAIQNVIKDPPFTRLDLLSCRN
LMIYLETEVQNRLIPAFHYALKPGGVLFLSPSESIGNYPELFAPLNRKWKFYRASGIVSS
TTAVMSGGLVWARNTNFKEPEEMIIKPRETNFSELTRSMLLQSYAPASVVTDEKGTILYV
HGDTGHYLRPAPGQATLNIIEMARDGLQMHLRNALSAAVSHAQLTLNHEVSIKRDGEMQH
MNLSVRQMHGPNREQRLFLVSFQDIAPLAGKRHKGAQPGMLELARVHELERELAYTKENL
QGTIEQQQSSNEELKSTNEELQSTNEELQSTNEELETSKEELQSVNEELVTVNAELQSKI
ELLALMQNDMKNLLDNINIGTLFLDNQLHIKRITRDAMKLFRLVSTDVGRPLSDIKSNIQ
NVELLTDAQSVLDTLVPFEREVTTNNGACYLARIQPYRTLDNVIDGVVLTFTDITQRKQV
EQAVIEAREMAEGIVNTIREPLLVLDSQLNIVSASRSFYQFFHTTEKATLGSSIYLLGNN
QWDIPELRNLLDTLVSGNQVIENFVVEHQFPLIGQRKLLLNARSITDGNNTRGLILLAME
EVA
Download sequence
Identical sequences D9SFV8
gi|302878605|ref|YP_003847169.1| WP_013293344.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]