SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SH27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SH27
Domain Number 1 Region: 14-199
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.1e-25
Family TehB-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SH27
Sequence length 200
Comment (tr|D9SH27|D9SH27_GALCS) Methyltransferase type 11 {ECO:0000313|EMBL:ADL55824.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_1814 OC=Gallionellaceae; Gallionella.
Sequence
MSVWNARYAGEEYHFGTEPNAFLVSQQNRLQPGTSCLAVADGEGRNGVWLTEQGLQVLSV
DSASVAVEKARALAQLRGVKMDCELVDLAHWDWPESRFDLVAGIFIQYANPAAREQQFAG
IKRCLKPGGLLLLQGYTPRQLEYKTGGPSAAENLYTEALLRDAFADMDILHLTEHDSELC
EGAGHCGMSALIDLVARKRT
Download sequence
Identical sequences D9SH27
gi|302879024|ref|YP_003847588.1| WP_013293758.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]