SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SHL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SHL0
Domain Number 1 Region: 104-244
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.44e-19
Family Catalytic, N-terminal domain of histone methyltransferase Dot1l 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D9SHL0
Sequence length 255
Comment (tr|D9SHL0|D9SHL0_GALCS) Uncharacterized protein {ECO:0000313|EMBL:ADL56007.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_2001 OC=Gallionellaceae; Gallionella.
Sequence
MLALFNRLPPSVTALLLQLAGGALSLLLLRITGINPVPLAFALLCGTLSAGLSHLAGQAR
WWLAIQLLFAPALVMTLSFDIPPWLFLAAFLIMLTVYWSTFSTQVPLYLSSNKVWHALED
LLPPESTRFIDLGSGLGGVLTHLARVRPDGHYSGVEYAPLPFLWSWLRTRPYPNCHVHWG
SIWDERLPACHLAQYDVVFAYLSPVPMEKLWHKAREQMRPGTLLISSTFSIPGHAPQQTV
QVDDLHQSTLQVWRM
Download sequence
Identical sequences D9SHL0
gi|302879207|ref|YP_003847771.1| WP_013293939.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]