SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SHN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SHN8
Domain Number 1 Region: 557-702
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.04e-36
Family Histidine kinase 0.0029
Further Details:      
 
Domain Number 2 Region: 480-552
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000102
Family Homodimeric domain of signal transducing histidine kinase 0.0024
Further Details:      
 
Domain Number 3 Region: 354-474
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000161
Family PYP-like 0.088
Further Details:      
 
Domain Number 4 Region: 303-347
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000497
Family HAMP domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SHN8
Sequence length 706
Comment (tr|D9SHN8|D9SHN8_GALCS) Multi-sensor signal transduction histidine kinase {ECO:0000313|EMBL:ADL54071.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_0026 OC=Gallionellaceae; Gallionella.
Sequence
MKYLIILSVIAGAALLFMLSSSSVNTEVFSINYYGLLGLMGLLAAGLLGLVVYQVWRLRV
KLKNKIFGAKLTLRLVLFFTLIAVLPGILVYAVSVNFLSKSIESWFDVRVEKALEGGLNL
GRSGLDNSLKELTQKTQFIALLLTEKNPAQFKNTLDQLIDEGVAQEAALFGAGDKMIAFS
ASDSALLPDIPSDKLMRQVREKGLYSAIEATPSRALSLRVLALVSVNSYSKASYVLQFNQ
LVPKQIAADAETVQAVYRDYQELTLSRLGLKRLYGITLTLALLVVLLTAISAAFFISERI
GSSLEALAVGTRAVAQGDFSGQHPIRSSDELGALTGLFNQMTRQLADARRASEQQQREVE
SAKGYLESVLTHLSSGVLALDDEFRLRSVNTSAAQILGAPLQELQRMPLQQIAEKYSLLH
SFCQTITEAFAQNGEWQRQIERLSRNGTQILLMRGTSLPQGSDAGYVVVFDDISHLLQTE
RQAAWGEVARRLAHEIKNPLTPIQLSAERLQYKLSSKLDETDAKLLQRATQTIVSQVGAM
KNMVTDFADYARGPVLKLLRLDVHKLIKEVLGLYEANAVPISLDLSEGRAEVNGDATRLR
QVLHNLLQNAQDALSGVEQPKIILSSQIVQGEIHLRVLDNGTGFSENALSRVFEPYMTTK
TKGTGLGLAIVKKIIEEHGGQIRVENNASGGACVNISLPLIQEVQV
Download sequence
Identical sequences D9SHN8
gi|302877271|ref|YP_003845835.1| WP_013292014.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]