SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SJ25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SJ25
Domain Number 1 Region: 34-244
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.84e-34
Family CAC2371-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SJ25
Sequence length 251
Comment (tr|D9SJ25|D9SJ25_GALCS) Methyltransferase type 11 {ECO:0000313|EMBL:ADL54301.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_0256 OC=Gallionellaceae; Gallionella.
Sequence
MSRLVQAAINKGAGLSDFQTNSDDWPEHAAAPNTHNRVLELVQQYLPAGLKVCDLPCGAG
MFSARLSQLGMDVTAVDLEAVEPFYFDKARRVLADANLILPFADGEFDALVSIEGIEHLE
NPSFFMRECARLVKPGGLVILSTPNVDSYRSRRSTYVHGFHKYFKPVSAHHKMAWHLHPI
DMTFVRGAVRKAGLEILEVAVNRMTGKNLWSEALRPIFNRKLPAELRGEIPYYGEVIIYI
LKKPAADGAGA
Download sequence
Identical sequences D9SJ25
gi|302877501|ref|YP_003846065.1| WP_013292244.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]