SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SJG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SJG4
Domain Number 1 Region: 305-460
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.9e-51
Family GGDEF domain 0.00011
Further Details:      
 
Domain Number 2 Region: 180-287
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.36e-29
Family Flavin-binding PAS domain 0.016
Further Details:      
 
Domain Number 3 Region: 27-169
Classification Level Classification E-value
Superfamily GAF domain-like 1.32e-26
Family GAF domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9SJG4
Sequence length 462
Comment (tr|D9SJG4|D9SJG4_GALCS) Diguanylate cyclase with PAS/PAC and GAF sensors {ECO:0000313|EMBL:ADL56352.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_2350 OC=Gallionellaceae; Gallionella.
Sequence
MKIAPLPHNERERLEELRKYGILDTEPEAVFNSMVQLASYICHTPFAAISLIDEHRQWFK
AIVGVEVSETPRDVAFCAHTILQQETMIVPNTLEDERFCDNPFVEGGLNLRFYAGVPLVT
ESGYRLGTLCVFDQQPRQLSAEQLDAIKTLADSVMAHLDLRLSHREIRKYVDDLQLAASI
FESASEAVLVTDPQNHIITVNPAFTAMTGYSLSEVAGKNPNILCSGKQSPAFYQRMWQSL
ADMGHWSGELWNKRKNGELFAEWLSINVLFNEDGSKRMYVAIFSDVTEKKQADEIIWRQA
NYDMLTQLPNRRLFCDRLEHEIRGAHRAGCLLALLFIDLDLFKEVNDSLGHEAGDALLVK
VAERLTASVRESDTVARMGGDEFTAILPQIDSLEDVERVAALIVKALSEPFEVNGAIVNI
SASVGVAIYPRDAKNTTELLSQADSAMYVAKEQGRGCYRMAN
Download sequence
Identical sequences D9SJG4
gi|302879552|ref|YP_003848116.1| WP_013294275.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]