SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9SJS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9SJS4
Domain Number 1 Region: 3-483
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.69e-120
Family N-6 DNA Methylase-like 0.0000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D9SJS4
Sequence length 491
Comment (tr|D9SJS4|D9SJS4_GALCS) Site-specific DNA-methyltransferase (Adenine-specific) {ECO:0000313|EMBL:ADL54423.1} KW=Complete proteome; Reference proteome OX=395494 OS=capsiferriformans (strain ES-2)). GN=Galf_0379 OC=Gallionellaceae; Gallionella.
Sequence
MSISSTIKSIQDIMRKDVGVDGDAQRLSQLVWMLFLKIFDDRESEWELLQDNYLSPLPEA
YRWRNWAANPEGMTGEALKQFLDNEMFPALQQLEARGGDQRAYVIRSVFEGAYNYMKSGQ
LIRQVVNKIQEGVDFNKAQERHLFGDMYEQLLRDLQAAGNAGEFYTPRAVTEFMVRMTNP
RLGEKVMDPACGTGGFLSCSIEHIRRQDVKTVDDEAALQASIFGIEKKPMPHLLCTTNMI
LHGIDVPSNIRHDNTLARPLISWTPKERVDVVVTNPPFGGMEEDGIETNFPAAFRTRETA
DLFLVLIMQLLKAGGRAALVLPDGFLFGEGIKTRIKEKLLEECNLHTIVRLPNGVFAPYT
GIKTNLLFFSKGAPTQHIWFYEHPYPAGVKSYNKTKPMKIEEFDVEAAWWGVESDGFSHR
VENEQAWKVSLDDIKARNYNLDCKNPHVGEQEIHDPDVLLAQYAAMQSEIAALRNQLKTI
LGEALNREVQA
Download sequence
Identical sequences D9SJS4
WP_013292366.1.12990 gi|302877623|ref|YP_003846187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]