SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E0DHK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0DHK5
Domain Number 1 Region: 5-277
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-73
Family Protein kinases, catalytic subunit 0.0000000835
Further Details:      
 
Domain Number 2 Region: 475-536
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000576
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 
Domain Number 3 Region: 543-604
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0046
Further Details:      
 
Weak hits

Sequence:  E0DHK5
Domain Number - Region: 677-742
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0589
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0DHK5
Sequence length 752
Comment (tr|E0DHK5|E0DHK5_9CORY) PASTA domain protein {ECO:0000313|EMBL:EFM48260.1} KW=Complete proteome; Reference proteome OX=553207 OS=Corynebacterium matruchotii ATCC 14266. GN=HMPREF0299_5159 OC=Corynebacterium.
Sequence
MSELIANRYELGSVVGSGGMSVVYSATDTLLGREVAVKMLRSELARDANFRERFRREAQN
AGRLNHPAIVAIYDTGETLHDGQSTPYIVMELVKGRNLKDIVADGGPLSPDEAATTLIPV
CEALQVSHDAGIVHRDIKPANVMITNTGVVKIMDFGIARALDDVTSHMTQTSAVIGTAQY
LSPEQARGKPVDGRSDLYALGCLMYDIMVGHPPFDGDTPFAVAYQHVQEDPTPPSEFIPD
LSPTAALNVDAVVLTAMAKHPGDRYQTAVEMAADLQRLEKNLVTMAARQYVDHDPEGAAS
LPGPAGIAAAELAAAGGAGAAGLAGAAGAAGAAGAAGLEAAGFAGTGAGVGAGAADATET
TVVPAVSEEFPPRPTPPMQSRRAAHAAPADPRMSPSRTPQGRAAGQHSAHAAQAGQVQRH
RRAELDADDYDSYEDRPRKGLRIALIVVAVLSLGVAAAFAYQYFSPTILPTKNNVTVPDL
RNQTKEDALAALEKLGLKTEVVNDASADVQEDHVVGTDPTANSTVKSGSTITVTVSSGRE
NTSVPDLSGKTTAEASAILKKKGLDLDPVVREGSSPKVERGKIMEQNPSAGTQVSKGSKV
TITVSTGEATTRVPVVTGMQWSQAEGNLTSLGFEPVVEFVDGSEPDGTVISVDGEGTQMP
AKSKINVKVSNGSLIQTPNLTNMTVDAAYSALQAAGWKGNRSQIVLGDPVKTGALVNGGR
IAQQTPAAGSPVRKDGTVTVQLWEFDITAIGR
Download sequence
Identical sequences E0DHK5
WP_005526714.1.76828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]