SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0EMF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0EMF1
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily MtlR-like 8.37e-52
Family MtlR-like 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0EMF1
Sequence length 174
Comment (tr|E0EMF1|E0EMF1_ACTPL) Mannitol operon repressor {ECO:0000313|EMBL:EFM89182.1} KW=Complete proteome OX=754255 OS=Actinobacillus pleuropneumoniae serovar 4 str. M62. GN=appser4_16840 OC=Pasteurellaceae; Actinobacillus.
Sequence
MPYSDNFIEQLSEVPSLRGFFALSVNQFAQNIERLIQRVFRKTDFALKSVVDSLFEHQGP
LAELTVRLKLLLGLGVISAAVFEDISLFIEVKQQLSDEVEELPFSHPAIVQFAKDLHHID
LSPVADLLKFASSVENKDSMLYQMQQIRLERVMRSSLILAITEINEKLNVESPL
Download sequence
Identical sequences A0A0S4QES6 A0A223MDK9 A3N2S6 B0BRV4 D9P7H1 D9PCC0 E0EAC7 E0EMF1 E0F070 E0FCJ8 E0FIM1
gi|126209092|ref|YP_001054317.1| gi|165977064|ref|YP_001652657.1| WP_005599023.1.11895 WP_005599023.1.1361 WP_005599023.1.34241 WP_005599023.1.38484 WP_005599023.1.46870 WP_005599023.1.47094 WP_005599023.1.59265 WP_005599023.1.61038 WP_005599023.1.6152 WP_005599023.1.71524 WP_005599023.1.74087 WP_005599023.1.77337 WP_005599023.1.77895 WP_005599023.1.79691 WP_005599023.1.86019 WP_005599023.1.86265 WP_005599023.1.87845 WP_005599023.1.91190 WP_005599023.1.97452 416269.APL_1628 434271.APJL_1661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]