SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E0RUT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0RUT1
Domain Number 1 Region: 167-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.09e-53
Family Methylesterase CheB, C-terminal domain 0.00002
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily CheY-like 2.13e-25
Family CheY-related 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0RUT1
Sequence length 356
Comment (tr|E0RUT1|E0RUT1_BUTPB) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=515622 OS=(Clostridium proteoclasticum). GN=bpr_I1384 OC=Butyrivibrio.
Sequence
MRKILLIDDSALMRTVLSDIINSDARFQVVDKAKDGVEGLELLKKNTYDAVVLDINMPRM
DGITMLKELQKLKIKAKIMMASTDTKEGAKVTMDCLDLGALDFVHKPDRASECRGEDFTK
IFINTLAAVAESRAPVSTKAFSIEDVKETRKVIDLVSKSANKITGNRIVAIASSTGGPRA
LQSVIPKLPKNLKTPVVLVQHMPEGFTASLAERLDSLSEVKVKEAAEGDVLTAGTVYISR
GGKHMHIVKSGGKSTIHYVDGPTREGVRPCANFMYESLMDSDFDEICCVVLTGMGADGTE
GIKNLKSKKKVFVIGQEESTCTVYGMPKAVATAGLVDQVVKLENVAQEIIMRVGVN
Download sequence
Identical sequences E0RUT1
gi|302670744|ref|YP_003830704.1| WP_013280776.1.55622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]