SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SQW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SQW3
Domain Number 1 Region: 8-195
Classification Level Classification E-value
Superfamily LigT-like 1.41e-36
Family 2'-5' RNA ligase LigT 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0SQW3
Sequence length 196
Comment (tr|E0SQW3|E0SQW3_IGNAA) RNA 2',3'-cyclic phosphodiesterase {ECO:0000256|HAMAP-Rule:MF_01940} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_1491 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MISMSERIRSFIAIEIEEQGVLAKIIRIKNSISDLGLDIKPVEDENIHITIRFLGEITLT
TLNEIKNILNNVTKIVKPFTIGVKGIGAFPNALRPRVIWVGISEGFDNLVAIRKYVDNEI
MRLKLIDVHRDEHEFSPHITIARVKSLRNINKFIEFYQSYKDFEFGVSPVSKIKLKQSTL
TPRGPIYKDIHVVNLM
Download sequence
Identical sequences E0SQW3
gi|305663885|ref|YP_003860173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]