SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E0SRY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SRY1
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Homeodomain-like 1.56e-23
Family Alr1493-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0SRY1
Sequence length 78
Comment (tr|E0SRY1|E0SRY1_IGNAA) Uncharacterized protein {ECO:0000313|EMBL:ADM27331.1} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_0493 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MEELLKRIVVDPKVMGGKPVIRGTRITVDLILELLASGMTPEEIAEDYKISVEDVRAALL
YAAKILGREEIMIVEAKT
Download sequence
Identical sequences E0SRY1
gi|305662923|ref|YP_003859211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]