SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0TKJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0TKJ2
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily L21p-like 1.16e-29
Family Ribosomal protein L21p 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0TKJ2
Sequence length 99
Comment (tr|E0TKJ2|E0TKJ2_MYCHH) 50S ribosomal protein L21 {ECO:0000256|HAMAP-Rule:MF_01363, ECO:0000256|RuleBase:RU000562} KW=Complete proteome OX=872331 OS=Mycoplasma hyorhinis (strain HUB-1). GN=MHR_0478 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MFAIIKTGGKQLIVKKDQTVFVEKLQGKEGDTVRFSEVVLINNKIGSPLVKNAYVEGVIE
KQGKSKKIVVYRHNAKSTHKRKLGHRQPYTRVKITELKG
Download sequence
Identical sequences A0A0E9AX28 E0TKJ2 K7X9U8
WP_013302298.1.33442 WP_013302298.1.37317 WP_013302298.1.46618 WP_013302298.1.49344 WP_013302298.1.74169 WP_013302298.1.85631 WP_013302298.1.89735 gi|304373264|ref|YP_003856473.1| gi|423263074|ref|YP_007013099.1| gi|378835948|ref|YP_005205224.1| gi|385858777|ref|YP_005905288.1| gi|558672078|ref|YP_008808787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]