SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E0VB58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VB58
Domain Number 1 Region: 33-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-73
Family Calponin-homology domain, CH-domain 0.0000608
Further Details:      
 
Domain Number 2 Region: 1260-1376
Classification Level Classification E-value
Superfamily E set domains 2.36e-28
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 1089-1183
Classification Level Classification E-value
Superfamily E set domains 1.08e-27
Family Filamin repeat (rod domain) 0.0000736
Further Details:      
 
Domain Number 4 Region: 921-1009
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.0000667
Further Details:      
 
Domain Number 5 Region: 461-577
Classification Level Classification E-value
Superfamily E set domains 4.07e-26
Family Filamin repeat (rod domain) 0.00061
Further Details:      
 
Domain Number 6 Region: 748-866
Classification Level Classification E-value
Superfamily E set domains 6.54e-26
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 7 Region: 284-381
Classification Level Classification E-value
Superfamily E set domains 1.93e-25
Family Filamin repeat (rod domain) 0.00052
Further Details:      
 
Domain Number 8 Region: 382-494
Classification Level Classification E-value
Superfamily E set domains 9.55e-24
Family Filamin repeat (rod domain) 0.003
Further Details:      
 
Domain Number 9 Region: 673-767
Classification Level Classification E-value
Superfamily E set domains 6.41e-23
Family Filamin repeat (rod domain) 0.00055
Further Details:      
 
Domain Number 10 Region: 580-670
Classification Level Classification E-value
Superfamily E set domains 1.07e-22
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 11 Region: 1356-1462
Classification Level Classification E-value
Superfamily E set domains 1.13e-21
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 12 Region: 1015-1108
Classification Level Classification E-value
Superfamily E set domains 3.5e-21
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VB58
Sequence length 1472
Comment (tr|E0VB58|E0VB58_PEDHC) Uncharacterized protein {ECO:0000313|EMBL:EEB10614.1, ECO:0000313|VectorBase:PHUM051710-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM051710 OC=Pediculidae; Pediculus.
Sequence
MSVFENEGTAVCLNTSEVSDQVLSEVDEDMSGAERDLAEDAQWKRIQQNTFTRWANEHLK
TVNKHIQNLETDLSDGLNLITLVEVLAGRKLPKHNKKPNFRSQKLENVSVALKFLEEDEA
IKIVNIDSTDIIDCKLKLILGLIWTLILHYSISMPVWDGEDDLTNGEKGATPKQRLLHWI
QSKVNDLPIGNFTTDWNDGKAVGALVDSVAPGLCPDWEDWDPKNSLNNATEAMNLADDWL
NVRQLIKPEELVNPNVDELSMMTYLSQYPNAKLKSGAPLRPKSDPHRVRAYGPGIEPRGN
VVGTPCNFTVETFSAGKGNVEVMVINSQGQQEPVNIKYNNDRNMTYSVFYIPQMEGNYKI
FVKYAGKDISKSPFQVFVEDGPGDASKVTAFGPGLEPEGNVANRTLHFDISTKDAKKGVP
EVIILDSAGVKSTVPAKVWQVSPELWRCEYTPHSVGLHSINILFAGQPIPHSPYGVRISP
VSDAKKVRVTGRGVQATGVRVQDVADFKIHMEKAGEGTPEVRVIGPGGVNEPVKIQKLDK
FTYEAAYKPRKEGRHVVMITLAEQEIPRSPFEVNVGPYKETNIKAYGPGLSGGVVGCPAL
FTVETNGETGALGFSIEGPSQAKINCKDNGDGSADVCYFPTAPGEYAVHILCDNEDIPKS
PYMSNILPAENFYPDKVECSGQGLQENGLISGQKTNFKIDTRKAGKAPLDVEILDKKGVP
IDSFITENNDGTYTCTYTPTDSKHTIQVNYGGVAVKNSPFRINVGEATFIDRIRIYGPGV
EKNVKSNNPTHFTVDCKEAGAGDLRLFMVNENKSEVPLKVTDVGNKIYVVEYYPSLPGIH
TLTAYYGNAPILPNPLKIPVSPHVDPSAIRVDDFNKSKIYLLLIFFFFLKFKRDIIEPCD
HYLVNILYLKKLIIIRRLLACVRASGLGLSRGLVRYPAEFIIDTRGAGQGSLGVTVEGPC
EAAINCRDNGDGTCSVAYLPTESGDYVVNITFNNEHIQGSPFQAIILSDDDIKDIEVSGN
GIQYEGVYVDSPTNFIIDSRAVNCQTDGKVTCNIMNPSGKKTENVISPMMDGIYKVSYTP
FEEGVHTIDILYDGIPISGSPFLVNVQRECSPKKCRAYGPGLQKGAGTGGLGLTIEGPSE
AKVTCKDNRDGSCTVEYVPTEPGDYDVSIKFSDQHITGSPFSVSNQVIAGVKFLPLLPLM
RLKQGKLLSGLIYPQLMVIIIIIIIIFFCPLKSEIKDNEDGTFTVFYVPPAEGANISARV
TYDHKDIPNSPFYLNVLPTVETDKVKLRGPGISNKGIPASVPTDFTIDVSDAGYGDLQVQ
VLGPDGYQKKVKILEEGNGIFKATYTPDDCGKYKINVKYGGMDLPVSPVNVQAVATGNAE
KCQIVEGIQRNLTSGEEYCITVNAKNAGYGAVTCKIRSSSGSDLDIDIEDNGDGTFKIYY
TVQDAGEYTISIKFGGQPIPDGFYSFTLLEVT
Download sequence
Identical sequences E0VB58
121224.XP_002423352 XP_002423352.1.24195 vb|PHUM051710-PA|EEB10614.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]