SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E0VH04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E0VH04
Domain Number - Region: 602-689
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00366
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E0VH04
Sequence length 710
Comment (tr|E0VH04|E0VH04_PEDHC) Sulfate permease, putative {ECO:0000313|EMBL:EEB12660.1, ECO:0000313|VectorBase:PHUM196650-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM196650 OC=Pediculidae; Pediculus.
Sequence
MDKRSESTVALTSYVPCSEDLEGGGNGGSIGPNGFTNVAAIDENDKTRHEKKNDNEINNS
TNNNSNEILINVNSLRWNKDVEYDGGQKNENHSSNVDNHLKVKLSDYNQSNNLPRLTSFE
KNSSPKKWLCKKVKKCCTKKLLYKRVPILSWLPQYSLNYAVADLVAGLTVGLTVIPQAIA
YANVAGLPPQYGLYSSFMACFIYAIFGSVKDSPIGPTAIAAILTRENLHGLGPEFAVLLC
FLSGCVELLMGILQLGFLIDFISGPVSAGFTSAAAIIIATSQVKDVLGLSFPGGNFLDVW
ENIFCNISNTRMGDAILGISCMIVLLVLRKIKDIPIGPRDVKEKTKMQKFLSQFLWLVST
SRNIVVVVVCGILAYAFHVEGEDGPFVLTGTVKGGLPSFHIPFYGAVDGNKTYSFSEVSS
NLGSAILVVPLLCILENISLAKVFAKGKSIDATQEMLAIGLCNIASSFVGSMPVTGALSR
GAVNNASGVQTTFGGIYTGIIVILSLQFFTPYFYYIPKSSLAAVIIAAVVFMVEFHVVKP
MWKTKKIDLIPAFATFLSCLFIRLELGIVIGISINVLFLLYASARPSVQVEKERTLSGIE
YLRITPDRSLVFPSVDYVRNVVTKAGVKQGSSYVPVVIDSKHIQGVDFTAAKGIKSLMDD
FVNRKQPILFYNLKPSIVDIFHSLRPKEFIYCTNENELNDFLKQHHVAGT
Download sequence
Identical sequences E0VH04
XP_002425398.1.24195 121224.XP_002425398 vb|PHUM196650-PA|EEB12660.1|Sulfate

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]