SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E0VTZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0VTZ5
Domain Number 1 Region: 275-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000157
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 
Domain Number 2 Region: 222-269
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000407
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E0VTZ5
Sequence length 380
Comment (tr|E0VTZ5|E0VTZ5_PEDHC) Zinc finger protein cchc domain containing protein, putative {ECO:0000313|EMBL:EEB16851.1, ECO:0000313|VectorBase:PHUM441140-PA} KW=Complete proteome; Reference proteome OX=121224 OS=Pediculus humanus subsp. corporis (Body louse). GN=Phum_PHUM441140 OC=Pediculidae; Pediculus.
Sequence
MTRFARAKGSKSCNDKVPEQASSWAELKKSVELKTESNEELPGEIVNRIKSKPATKEPIK
WAPLDVDTVEIECDVEKKRQKKMSDSTNSKSESLEENSKPEKKKKKKLKKENSQGGNENK
TGNVKNAAATAAGNSKKVKSKNFKEKDKFPRKNNSDGTFVEEIMVNGEKVKVVKFQGFNV
THDDAVRLKELKTEMYKQGIPRDKLEAALKLERRRAEKSLSRLKKSVCFHCRGSGHVLSQ
CPSLTETENTGTGICYKCGSTEHSAIECKVVKGSSFQFAECFICKEQGHIARQCPDNPRG
LYPHGGACRECGDVTHLRKDCPKTVVKKEKETMTLGIRNDRNVETLEEEMVFNRGGGGGG
KTPTKKNGDVNGKRKSLVKF
Download sequence
Identical sequences E0VTZ5
121224.XP_002429589 XP_002429589.1.24195 vb|PHUM441140-PA|EEB16851.1|zinc

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]