SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1B8X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B8X6
Domain Number 1 Region: 244-307
Classification Level Classification E-value
Superfamily RILP dimerisation region 5.89e-18
Family RILP dimerisation region 0.0000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1B8X6
Sequence length 407
Comment (tr|E1B8X6|E1B8X6_BOVIN) Rab interacting lysosomal protein {ECO:0000313|Ensembl:ENSBTAP00000048816} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RILP OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEPRRAVPGAHGCGPRVAAGSGTAAELVYHLAGALGAELQELARRFGPEAAAGLVPLVVQ
ALELLEKAAVGPTPDSLQVSAQHAELELRRLREENERLRRELRSGPQEERALLRQLKEVT
DRQRDELRAYNRDLLQRSQETEALQEQLQRLLLVNAELRQKLAAVQTQLRAARDRESERE
QRREAAVEPPPEPVQGQAAGPGCEQRRESERAAAGTRAPGTPEDPADAPLPPGLPAKAGQ
CSFSREEVQQILQERNELKANVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRKK
IKAKMLGTPEEAESSDDEDGSWLLLSSDKGDHSEPPAPESRIQSFFGQWYRGEAEAPGTE
TSRVAPSQLQGGEETLQPPHQEPPPTPDGSCCALNEHLCLESQLPQR
Download sequence
Identical sequences E1B8X6
ENSBTAP00000048816 ENSBTAP00000048816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]