SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1B9L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1B9L4
Domain Number 1 Region: 489-556
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000126
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 143-203
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000167
Family VWC domain 0.0026
Further Details:      
 
Domain Number 3 Region: 1158-1219
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000167
Family VWC domain 0.014
Further Details:      
 
Domain Number 4 Region: 316-381
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000408
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 606-671
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000272
Family VWC domain 0.011
Further Details:      
 
Domain Number 6 Region: 784-850
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000293
Family VWC domain 0.012
Further Details:      
 
Domain Number 7 Region: 961-1026
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000544
Family VWC domain 0.0063
Further Details:      
 
Domain Number 8 Region: 204-262
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000068
Family VWC domain 0.015
Further Details:      
 
Domain Number 9 Region: 903-968
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family VWC domain 0.017
Further Details:      
 
Domain Number 10 Region: 264-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000157
Family VWC domain 0.024
Further Details:      
 
Domain Number 11 Region: 1020-1095
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000575
Family VWC domain 0.01
Further Details:      
 
Domain Number 12 Region: 843-897
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000691
Family Fibronectin type I module 0.086
Further Details:      
 
Domain Number 13 Region: 374-436
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000827
Family VWC domain 0.038
Further Details:      
 
Domain Number 14 Region: 435-497
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000167
Family VWC domain 0.0033
Further Details:      
 
Domain Number 15 Region: 727-781
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000251
Family VWC domain 0.081
Further Details:      
 
Domain Number 16 Region: 1488-1553
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000327
Family ATI-like 0.037
Further Details:      
 
Domain Number 17 Region: 555-608
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000816
Family VWC domain 0.032
Further Details:      
 
Domain Number 18 Region: 1103-1154
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000167
Family VWC domain 0.0077
Further Details:      
 
Domain Number 19 Region: 97-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000963
Family VWC domain 0.051
Further Details:      
 
Domain Number 20 Region: 687-733
Classification Level Classification E-value
Superfamily FnI-like domain 0.000023
Family VWC domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1B9L4
Sequence length 1577
Comment (tr|E1B9L4|E1B9L4_BOVIN) Kielin/chordin-like protein {ECO:0000313|Ensembl:ENSBTAP00000033479} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=KCP OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MARAVAVLLSLILQLASRTLAPGTSRGGAISREPLGLADIQDYQSEGPAHSSAPAGVPEE
WWRPLEEQLERLEAEVTELREQNKDLQGRVTQLESCECHPASPQCWGLGRAWPEGARWEP
DACTACVCQDGAANCVPKPGLARCHGCSHNGQAYGNGETFTPDACTICRCLAGTVRCQGP
SCSELNCLESYTPPGECCPVCRPGCEYEGQLYEEGANFWSSSNPCLQCSCLRSLVRCVPT
KCPPIPCPKPVLRPGHCCPTCQAQGCTENGSHWEHGQEWTTPGDPCRICQCLEGHILCRQ
RECASLCPYPARPLPGTCCPVCDGCFLNGRDYRSGEPVGSGDPCSRCRCVNGSVQCEPPP
CPPTPCRHPGRTPGECCPVCDSCEYQGHKYQNQETFQLQESGRCAHCSCQAGEVSCEERE
CPGMPCTLPDSGPEPCSVCVLDEEEFAEGVQWEPDGQPCTTCSCQAGVPVCGTLLCSPAP
CQHPTQPPGACCPSCENCTYHGQVYANGQNFTDADPCHTCHCEDGTVTCSLVNCPPTTCA
RPQRGPSQCCPRCPDCVLEKQVFLDGERFSHPRDPCQECQCREGHAHCQPRLCPRTSCAH
PLPGVCCQNNCNGCAFGGKEYPNGADFPHPSDPCRLCHCLGGTVQCLARRCPPLPCPEPV
LLPRQCCPRCPAAPSGCPRPGGLVPAHHQEYFSPPDDPCRRCLCLDGSVSCRRLPCPPVP
CTHPHQGPCCPSCDGCLYQGKEFTSGERFPSPTARCHICLCWEGSISCEPRACAPAQCPF
PAQGDCCPACDGCEYLGESYLSGQEFPDPREPCNLCTCLGGFVTCGRRPCEPLGCSHPLT
RAGHCCPTCQGCLYHGVTAAPGETLPDPLDPACSLCTCQEGSMRCQKKPCPPALCPRPSS
GPCFCPVCHSCLSQGQEHQDGEEFEGPTGSCERCLCQAGQVSCVRQRCPPLSCPLQVTEP
GSCCPRCRGCLFHGEEHPEGSSWKPPDSPCSSCMCHEGVITCARIQCVTSCAQPHQGPSD
CCPRCSDCEHEGRKYEPGESFQPGADPCEVCVCELQPEGTPSLRCHRRQCPHLAGCPTSQ
LLTPGPQQCCPTCAEALSHCTEHLLGSELTPPDPCYSCQCQDLTWLCIHRACPELSCPLP
ERYIPPGSCCPMCQAPAPSCAHQGRQVASGERWDVDACTNCSCMAGTVRCQSQRCPPLSC
GPDEAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCRGGDFS
VHVTNDDRGRSGVSWTQEVAVLLGDVAVRLLQDRAVTVDGRPVALPFLQEPLFYVELRGR
TVVLHSQPGLQVLWDGRSQVEVRVPGSYRGHMCGLCGNFNGFAQDDLRDPEELLRSTEAA
FGNSWQVPEGPGPGRPCSKGREVDPCQAAGYRARREANARCAVLKSAPFSRCHAVVPPDP
FFAACVYDLCACGPGSSSDACLCDALEAYASHCRQAGVTPAWRGPTLCVVGCPLDRGFVF
DECGPPCPRTCFNKHVPLGELAAHCVRPCIPSCQCPAGLVEHEGHCISPEACPSVLLTGD
QLPSTPRNPSQELQGPT
Download sequence
Identical sequences E1B9L4
ENSBTAP00000033479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]