SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1BFR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BFR6
Domain Number 1 Region: 273-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.05e-89
Family Eukaryotic proteases 0.0000385
Further Details:      
 
Domain Number 2 Region: 184-280
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-19
Family Hepsin, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BFR6
Sequence length 527
Comment (tr|E1BFR6|E1BFR6_BOVIN) Transmembrane protease, serine 13 {ECO:0000313|Ensembl:ENSBTAP00000010989} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TMPRSS13 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PSPPHSPADCTPSAGTLSTGPSSLSSCCSPVPNASPAGTPPPRAFPGRAPAARASPSRSS
SGRSSSTMSPLTTSSPTRVYLVRATPVGTVPVHASPAGPTPAARAARESPGITLPKFTWQ
EGQKRLLLIGCVLLLIALVVSLIILFYFWRGHTGVNYKEPRESCPSHAVRCDGVEDCKLK
SDELGCVRFDWDKSLLKVYSGSSHQWLPVCSDSWNDSYSQKTCQQLGFESAYWTTKVDNR
NVDSSFSVSEFNSTIQQSTYRSDCPSQQYVALQCSHCGLRAMTGRIVGGARAPESKWPWQ
VSLQFSRTHICGGTLIDAQWILTAAHCFFITREKILEGWKVYVGTNDLHHLPESASVAQI
IINSNYSDDQDDYDIALMRLSKPLTLSAHVHPACLPMHGQTFGLNEICWITGFGKTKETD
ERTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQN
GRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMEREMRFRKS
Download sequence
Identical sequences E1BFR6
ENSBTAP00000010989 ENSBTAP00000010989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]