SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1BH85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BH85
Domain Number 1 Region: 103-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000178
Family VWC domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BH85
Sequence length 222
Comment (tr|E1BH85|E1BH85_BOVIN) von Willebrand factor C domain containing protein 2 like {ECO:0000313|Ensembl:ENSBTAP00000024690} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=VWC2L OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQTSSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV
Download sequence
Identical sequences A0A1S3GX11 E1BH85 W5QDA3
ENSBTAP00000024690 NP_001178088.1.59421 NP_001178088.1.76553 XP_004004952.1.66739 XP_005202848.1.76553 XP_005909651.1.15283 XP_005972210.1.78601 XP_006045713.1.26621 XP_006184364.1.101512 XP_006210027.1.17985 XP_010614333.1.5607 XP_010958356.1.22495 XP_010990783.1.51371 XP_012893225.1.60039 XP_015336818.1.40921 XP_019841045.1.53367 XP_020737373.1.74333 ENSOARP00000020701 ENSBTAP00000024690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]