SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1QLC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QLC8
Domain Number 1 Region: 5-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.77e-55
Family G proteins 0.00022
Further Details:      
 
Domain Number 2 Region: 186-307
Classification Level Classification E-value
Superfamily Translation proteins 8.84e-30
Family Elongation factors 0.003
Further Details:      
 
Domain Number 3 Region: 404-518
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.58e-25
Family EF-G/eEF-2 domains III and V 0.009
Further Details:      
 
Domain Number 4 Region: 309-393
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000302
Family EF-G/eEF-2 domains III and V 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1QLC8
Sequence length 607
Comment (tr|E1QLC8|E1QLC8_DESB2) GTP-binding protein TypA {ECO:0000313|EMBL:ADK86363.1} KW=Complete proteome; Reference proteome OX=644282 OS=2st14). GN=Deba_3010 OC=Desulfarculaceae; Desulfarculus.
Sequence
MASNMQQRQDLRNLAIVAHVDHGKTTLVDAMLWQSGVFRENEKVAERVMDSLDLEREKGI
TIMAKNTAITYNGVKLNVVDTPGHADFGGEVERTLNMVDGVMLLVDASEGPLPQTRFVLS
KSLERKLPLVAVINKIDRPDRRIKEVENELYDLLIDLGAEDDQLDFPILYTNAKAGVAQN
SPDEQGVDLQPLFEAILAHIPPPSFDPEAPLQFLVTNLDYSDYVGRIAVGKIVGGRLRAG
GQVLLLKKGQPAGRFGLSQVYTYRGLERLAADDIAAGDIAAVAGVDDAFIGDTLADPEDP
RALPVISVEEPTMSMEFSVNSSPLAGREGSLLTSRQIKARLEKETLYNVSIRVEPGQATD
SFKVSARGELQLAVLVETMRREGFELGLSKPRVITQLIDGVVHEPLELAVVDVPDEYVGV
VTEKLSARRGKMTRMQNNGQGRTRLEFEIPTRGLIGYRSQFLTDTRGAGILTTLVIGHAP
HAGEIAGRSNGSLVSDRMGKAVAYAIYHLQPRGSIFVEPGDPSYPGLIVGQNSRGEDIAV
NITKEKKLTNMRASGADEALRLTPPRRFTLEQAMEYIDDDELVEVTPKSIRLRKKDAQKL
GGARKKI
Download sequence
Identical sequences E1QLC8
gi|302344428|ref|YP_003808957.1| WP_013259800.1.88723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]