SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1QQ95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QQ95
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 3.97e-67
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000232
Further Details:      
 
Domain Number 2 Region: 253-464
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 9.6e-57
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1QQ95
Sequence length 469
Comment (tr|E1QQ95|E1QQ95_VULDI) Vinylacetyl-CoA Delta-isomerase {ECO:0000313|EMBL:ADN51582.1} KW=Complete proteome; Reference proteome OX=572478 OS=IC-017). GN=Vdis_2214 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MPRSATDYINSVRDGRVVYYRGKRVDDITTHPIISIAVRHAADLFDVKDRLYDDPNYGRI
SRYFKVPKNTNDLLERHKLIYEDTLRFDGLFNIVQAIGSDALFSLMIIARKVDRKYGTNY
YDRVMKYYEYVVKNDLAIAVAQTDVKGNRAKRPHEQEDRDMYLRVVEVRDDGIVVNGAKI
HTTQGPVANEIIVLPYRAMVEGDRDYAVAFAVPANAKGLKFIVRPVLEYDGNPNAVNAAS
RFEVESLTIFDHVFVPWDRVFMFREWDLAGQLAWTFATYHRFTAISYRAATANLYLGAAL
YAARANGIENAPHVRDWLVQMIMYKEIMRMGAMAAALEPWIDEGIAIPNPIYTNVSKLYA
NAHFIDVVHGLIDIAGGLIATMPSHDDYANPEERQYISKYLRGAVDGDTRYKVMSLVREL
GASHLVGYLLTAMIHAEGSEAASKIGMLREYNYKEAEELINKILSKIKL
Download sequence
Identical sequences E1QQ95
gi|307596316|ref|YP_003902633.1| WP_013337307.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]