SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1QRU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QRU6
Domain Number 1 Region: 4-246
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.69e-64
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00084
Further Details:      
 
Domain Number 2 Region: 235-375
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 5.48e-16
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1QRU6
Sequence length 377
Comment (tr|E1QRU6|E1QRU6_VULDI) Acyl-CoA dehydrogenase domain protein {ECO:0000313|EMBL:ADN50663.1} KW=Complete proteome; Reference proteome OX=572478 OS=IC-017). GN=Vdis_1277 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MSESELERFRDYVKDWFIKNAPPEMRIRRGGIGWYYEDPRFIDAAVRWHRTLYNAGLVGI
SWPKEYGGYGDDVRKELVVRDVALSLGIVYPGCPGIGLSVAGPAILFHGSEEQKRRYLRR
ILTCEDVWAQGFSEPCCGSDLAAITTKAEDRGDYFVLNGRKVWSSDFHLANYYLVLARTG
SPEERHKGLTMFIVDTRSEGITYRPIKQINGRPGFSEVFLDNVKVPKDNVVGKVGDGWRV
AMTTLNFERLNIGGAFAYAAASAARHLVEVRRDADTLALLEEALAVKELYDRMLMLALRG
EMVGPEAASIKLLASEVLEKIYIAAVSKLGPEALAEGDLFEWSFGYIDSKGYTILSGTSE
ILRNLLGELVLGLPKGV
Download sequence
Identical sequences E1QRU6
WP_013336388.1.43420 gi|307595397|ref|YP_003901714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]