SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1QTQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QTQ3
Domain Number 1 Region: 3-262
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.72e-62
Family PFOR PP module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1QTQ3
Sequence length 279
Comment (tr|E1QTQ3|E1QTQ3_VULDI) Thiamine pyrophosphate protein domain protein TPP-binding protein {ECO:0000313|EMBL:ADN50970.1} KW=Complete proteome; Reference proteome OX=572478 OS=IC-017). GN=Vdis_1591 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MNPLIRKYLRSEYAQGKRRTIFCPGCGNGIILGYFIRAIDELKREGRFDDSKLYIVTGIG
CSGNIPVPLKYNIVRALHGRALSVATGIKLVRPDSEVVVFAGDGDLLSIGGNHLIHTIRR
NVGIKVILVNNMLYGMTGGQVAPTTPMDAITHTTPYGNPEPPLDACRLAVSLGATYVARW
AVPLAKQCIQSIKELLLHRGFGLLECLSQCPVYQGRYVIGIDRPSKIMDYFLKITVVSNE
PRYGDKIIIGKFADYERPTYEEIMWGIMSRVREDGGHEA
Download sequence
Identical sequences E1QTQ3
WP_013336695.1.43420 gi|307595704|ref|YP_003902021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]