SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1QTU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QTU4
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.63e-71
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000185
Further Details:      
 
Domain Number 2 Region: 228-380
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.47e-51
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1QTU4
Sequence length 387
Comment (tr|E1QTU4|E1QTU4_VULDI) Acyl-CoA dehydrogenase domain protein {ECO:0000313|EMBL:ADN51011.1} KW=Complete proteome; Reference proteome OX=572478 OS=IC-017). GN=Vdis_1633 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MPDPFLTDEHQLIRNSVKEFAERYIVPIARKMDLEDYYPRDLIRELGKQGFLTPSAPPEY
GGPGIDLRGSVVVVEELSRYSPTLGFITEIVNDNIVYALLKYGSNKQKEEILPKIASGEW
VASYALTEPCCGTDAAAIETRAERRGGEWVINGRKIWITQGAYADIYLLFARTGPKEARH
RAITAFLVRRGDCVEVSKLEMMGMRGAGEAEVKFNDCVVGDDDVLGKINEGFKIAMVTLD
LARIGISGVAVGLSQGVLDEALEWAKTRTAFGKPLIDWEWIQFQLADMKAKLEIGRTVTY
KAAWLYDNKDPSFILYASIAKLYTAQMAVEIARDGVQILGGFGYSKESFSERAYRDAKVL
EIAEGTNEAQRIVIHRILARGLPEVEL
Download sequence
Identical sequences E1QTU4
WP_013336736.1.43420 gi|307595745|ref|YP_003902062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]