SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1QZ32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QZ32
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily DTD-like 6.67e-53
Family DTD-like 0.00000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1QZ32
Sequence length 154
Comment (tr|E1QZ32|E1QZ32_OLSUV) Gly-tRNA(Ala) deacylase {ECO:0000256|HAMAP-Rule:MF_00518} KW=Complete proteome; Reference proteome OX=633147 OS=NCIMB 702895 / VPI D76D-27C) (Lactobacillus uli). GN=Olsu_0531 OC=Atopobiaceae; Olsenella.
Sequence
MRALVQRVSEASVAVGGEVVGQCGRGLVVLLGVGPNDDETSCRRLWDKVRDLRVFDDADG
RMNLALGAVGGGVLVVSQFTLYADCRRGLRPSFTGAANPQLGRRLYDRFCALAERDVSHV
GRGVFGADMQVSLVNDGPVTIWLDTDELSRRGVG
Download sequence
Identical sequences E1QZ32
gi|302335319|ref|YP_003800526.1| WP_013251398.1.19134 WP_013251398.1.33448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]