SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1V926 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1V926
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.64e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1V926
Sequence length 316
Comment (tr|E1V926|E1V926_HALED) Thioredoxin reductase {ECO:0000256|RuleBase:RU003881} KW=Complete proteome; Reference proteome OX=768066 OS=2198 / 1H9). GN=HELO_3814 OC=Halomonadaceae; Halomonas.
Sequence
MSEARHERLIILGSGPAGYTAAVYAARANLKPLLITGIQAGGQLTTTTDVDNWPGDDIGV
QGPELMERMKRHAERFETEVLFDHVHEVELRERPFTLKGDNGTYTCDALIIATGASARYL
GLESESRFMGQGVSACATCDGFFYRNQDVVVVGGGNTAVEEALYLSNIASKVTLVHRRDS
LRAEKILQDKLFDKVENGNIEVIWNHTLDEVLGDNTGVTGARLKSTEDGSTRELDAPGVF
IAIGHSPNTGIFEGQLDMAGGYIKVQSGLEGNATATSVPGVFAAGDVMDHVYRQAVTSAG
SGCMAALDAERYLDEL
Download sequence
Identical sequences A0A1B8NX36 E1V926
gi|307546404|ref|YP_003898883.1| WP_013333570.1.66923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]