SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1W606 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1W606
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.45e-94
Family Methylenetetrahydrofolate reductase 0.00000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1W606
Sequence length 296
Comment (tr|E1W606|E1W606_HAEP3) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=862965 OS=Haemophilus parainfluenzae (strain T3T1). GN=PARA_17000 OC=Pasteurellaceae; Haemophilus.
Sequence
MSYANEINTLNQHLADTNKKINVSFEFFPPKNEKMESMLWDSIHRLKVLNPKFVSVTYGA
NSGERDRTHSIVKAIKAETGIEAAPHLTGIDATPEELKEIAKDYWDSGIRRIVALRGDEP
KGYAKKPFYAADLVELLRSVADFDISVAAYPEVHPEAKSAQADLINLKRKIDAGANHVIT
QFFFDIDSYLRFRDRCASIGIEAEIVPGILPVTNFKQLQKMASFTNVKIPAWLAKAYEGL
DDDPTTRNLVAASVAMDMVKILSHEGVNDFHFYTLNRSELTYAICHTLGIRPTANP
Download sequence
Identical sequences E1W606
gi|345430266|ref|YP_004823386.1| WP_014065429.1.68312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]