SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1YH62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E1YH62
Domain Number - Region: 38-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00131
Family Capz alpha-1 subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1YH62
Sequence length 173
Comment (tr|E1YH62|E1YH62_9DELT) Uncharacterized protein {ECO:0000313|EMBL:CBX29906.1} OX=201089 OS=uncultured Desulfobacterium sp. GN=N47_F16010 OC=Desulfobacteraceae; Desulfobacterium; environmental samples.
Sequence
MRISVPQRNLQKFKEVLIYILEKIGSKPNVGETVLYKLLYFMDFNFYEKYEEQLIGATYI
KNKYGPTPKEFVKIIEEMEGKDLVKVKDSYFKYPQTKYLPLRKSDLTQLKAHEKEVIDDV
LNTLSNMNASEISEYSHNDVPWKTTEDGDIIQYEAVFYRTSPYSVRNYNEESI
Download sequence
Identical sequences E1YH62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]