SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2ABH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2ABH5
Domain Number 1 Region: 608-734
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-37
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 922-1004
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-19
Family Ras-binding domain, RBD 0.007
Further Details:      
 
Domain Number 4 Region: 194-302
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000328
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 5 Region: 866-932
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000148
Family Ras-binding domain, RBD 0.027
Further Details:      
 
Weak hits

Sequence:  E2ABH5
Domain Number - Region: 1266-1313
Classification Level Classification E-value
Superfamily AMPKBI-like 0.0153
Family AMPKBI-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2ABH5
Sequence length 1314
Comment (tr|E2ABH5|E2ABH5_CAMFO) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:EFN69214.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_09344 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MHQNRRKKKRVNYGVRAVEVIRGAKGFGFTISGQQPCILSCIVQGSPAEGAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGNSKGVLRLQIAENYYSDSDEEGLATVRSKPKYAHKPRVAN
ASALQLQCRAAKVVRDLQSGAMFHASLGNLASDSKDQYNYSVLHYRWNMTSPLPPPPPPV
SHKRDSEKIVHRTVVGYLGTIDIPNQLHPSCMMQVLRKCIKRLKAEKRNPTTVLLTIHVA
NIKLTNSENRVIAEYPSYRIIFCNSFSEQDKQYFGILTKSMKNTDDIVSNSCHVFTIYYK
LIDHEVHSSACNVFGFTCTKSSELNVCQEFPDSCTGLIGAIQTLYISDCTNGENPYNEAR
IRLDAASPQPSNVSTSTAHSSNSDSGIGFKDDYGSCSGQNTANDCERRRQHPSNVQYKNI
NAQSSRESASEVAEHRLTVRAISETKWNKEPKFIDFSKGMRHVTGSGEGTTTCAGTSAPV
MAAHNSLASTSVGSLASVCTTALLDGIEDAAESSKAASTAKLKRLMDTTNKLSPKVYCGQ
VTKSLVHSLEDINSSMEYARPPFCHSYSKSDKPRPWGSLQEIRNFGNSVSDNCIYGSTES
CDKNNDCKGVHTWANGFEKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYKDTKDTGM
RRRLACQIYQRHLSNTAAEPVNVDSHASGQITQELLDEAPADLFLQAQKQVFNLMKFDSY
PRFLRSELYRACLEAGNTIVDTEDCDLHLTNSPSVKLKKSHSDAEDRCRKSILPWSRKNR
SKSKDRGETEYNKVPSRNETIYKSFTTIKRDTEGNNNEDSVSISSSRSSLASWDLALRQS
FNKHSLSSCDGQTNEKRDARSKCTGLCRVILPDGSTTVVTTSQTESIKDVVTRLLDKRAL
RYSNYDVLILATDEMVDTKCFSSVLAGQEVEVVLTKVLKVELPSRRIISVIAHKGKTLKE
VLRPLLNKYGFNLDLISIWSEGHCVPMDIMAINAPTRLIVVANEEDFQRELHTAKYLDEV
SHVQPTLDEITNKVFEELLVGKSRNKYQYSEGSCKSDDQRSEGSSILSSKFFLRDSTIHG
KKKAKSKYCNTTDKGNTNDCVHEGAPVKSHPPLIAKWRNGVKLQLPGRFDGDDLYEGLKR
AQRSRLEDQRGTEINFELPDFLKNKENGKPSDSNKMRRTRVVSANCEGTTKFYDSSEDKQ
SSCSGYDYPAHVTNGVLNERFSALVTEPLNKCLDSSFTLDGDRTLVDADQTIIENCTNSQ
SKTSCSESYGSDMSRTKLSKPPPLPPKPKNLVVNVKSGYVMSPKTLQRPNHVIE
Download sequence
Identical sequences E2ABH5
Cflo_11418--XP_001122276.1_APIME XP_019882874.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]