SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2ART4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2ART4
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.66e-32
Family Skp1 dimerisation domain-like 0.0000125
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily POZ domain 2.35e-23
Family BTB/POZ domain 0.0000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2ART4
Sequence length 162
Comment (tr|E2ART4|E2ART4_CAMFO) S-phase kinase-associated protein 1 {ECO:0000313|EMBL:EFN63852.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_10282 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MPNIKLQSSDGEVFEVDVEIAKCSVTIKTMLEDLGMDEDEEEVVPLPNVNSAILRKVIQW
ATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTASEEEQVRKENEWCEEK
Download sequence
Identical sequences A0A151IY69 A0A151WXX8 A0A158NZR5 A0A195BEG5 A0A195F2K6 E2ART4 E2BWQ3 F4WI69
Hsal_09934--XP_392758.2_APIME AC02969-PA Aech_04328 PB19447-RA XP_011053303.1.86870 XP_011146431.1.56509 XP_011146432.1.56509 XP_011158680.1.47049 XP_011262894.1.72520 XP_011262895.1.72520 XP_011637598.1.19355 XP_011700613.1.89273 XP_012063023.1.45171 XP_014483819.1.44477 XP_018048685.1.4000 XP_018048686.1.4000 XP_018307146.1.62676 XP_018348774.1.14990 XP_018371906.1.32933 Cflo_05377--XP_392758.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]