SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2B2P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2B2P4
Domain Number 1 Region: 625-750
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.88e-37
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 12-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.29e-20
Family PDZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 937-1019
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-19
Family Ras-binding domain, RBD 0.0079
Further Details:      
 
Domain Number 4 Region: 195-305
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000424
Family Phosphotyrosine-binding domain (PTB) 0.0099
Further Details:      
 
Domain Number 5 Region: 882-948
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000709
Family Ras-binding domain, RBD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2B2P4
Sequence length 1334
Comment (tr|E2B2P4|E2B2P4_HARSA) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:EFN90026.1} KW=Complete proteome; Reference proteome OX=610380 OS=Harpegnathos saltator (Jerdon's jumping ant). GN=EAI_05012 OC=Vespoidea; Formicidae; Ponerinae; Ponerini; Harpegnathos.
Sequence
MHQNQRRKKKRVNYGVRAVEVIRGAKGFGFTISGQQPCILSCIVQGSPAENAGLRAGDYL
VAVNGHNVSKVPHDDVVQLIGNSKGVLRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRA
TNAGALQLQCRVAKVVRDLQSGAMFHAVGSSTMSENKDHYGYSGLHYRWNMTSPLPPPPP
PVSHKRDSEKIVHRTVVGYLGTIDIPNQLHSSCMMQVLRKCIKRLKAEKRNPTTVLLTIH
VANIKLTNSENRVIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRDTDDIVSNSCHVFTIY
YKLIDHQVHSSACNVFGFTCTKSSELNVCQEFPDSCTNLIGAIQTLYISDCTNGETNPYN
EARIRLDAASPQPSNVSTSTAHSSNSDSGIGFKDDYGSCSGKNTANDCGRRRQCPSNMQY
RNVTARTSRESISEAAGHRLAVRATSEVRWNKELKFDPAKEMRLTVGNSGGTTTTCVPAG
TSAPVAAAVTTTAVRGCALASTSVGSLASVCTTAMLDGIEDDTAESSRTTSSTEKTKQRF
TDAINNKLSPKVYCGQVTKSLVHSLEDVNSSMEYARPFCHSYTGKQDKPRPWGSLQEIRN
LGNSVSDNCIHGSTESCDKNNDCKGVHMWANGFEKLLDDPKGLQTFAEFLKKEFSHENIY
FWAACERYKDTKDAATRHRLACQIYQRHLSSTAAEPVNVDSHASGQITQELLDEAPADLF
LQAQKQVFNLMKFDSYPRFLRSELYRACLEAGTAIVNTEDCDLHLTSSPSVKLKKSHSDA
EDRCRKSILPWNRKNRSKSKDRGETEYNKVPSRSETIYKSFTAIKRETEGNNNEDSVSIS
SSRSSLASWDLALRQSFNKHSVSSCEGQANDKKEARNKCTGLCRVILPDGSTTVVTTSQT
DSIKDVVTRLLDKRALRYINYDVLILATDEMVDTKCPSSVLASQEVEVVLTKVLKVELPS
RRIISIIAHKGKTLKDVLRPLLNKYGFNLDLISIWSEGHCVPMDVMAINAPTRLIIMANE
EDFQRELHTAKYLDELPHAQPTLDEITNKVFEELLVGKSRNKYQYSEGSCKSDDQRSEGS
SILSSKFFLRDSTIHGKKKAKSKCCNTSEKGNTNDCIHEGAPVKSQPPLIAKWRNGVKLQ
LPGRFDGDDLYEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGKPSDCNKMRRSRVVSA
NCEGTTKFYDSNEDKQSCSSGYEYPAHVTNGGGVNERFSALVNITEPLSKCLDSSFTLDG
DRTLVDGDQTVIENGTSPQSKTLHSGSYGADASRAKLPKPPPLPPKPKNLVVNVVKSGYI
MSPKSLQRSNHVIE
Download sequence
Identical sequences E2B2P4
XP_011148967.1.56509 Hsal_11831--XP_001122276.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]