SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2BDL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2BDL0
Domain Number 1 Region: 49-190
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.11e-29
Family Insect phospholipase A2 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2BDL0
Sequence length 229
Comment (tr|E2BDL0|E2BDL0_HARSA) Phospholipase A2 {ECO:0000313|EMBL:EFN86172.1} KW=Complete proteome; Reference proteome OX=610380 OS=Harpegnathos saltator (Jerdon's jumping ant). GN=EAI_11259 OC=Vespoidea; Formicidae; Ponerinae; Ponerini; Harpegnathos.
Sequence
MTPTALALFPALLLLSRDARGWSIAFPNISEALANDLRDSSQERTPPLIFPGTKWCGSGN
IASSQDDLGTFAMTDACCREHDECGDIIEAMQTAHGLTNPAFYTSGNLIECHEMYQIRLH
CSCDERFYDCLHSSEELVSAKVGFLYFSVLNTKCFREDYPIVGCKRHSLRCLEYELDESQ
PKMYQWFDVPAYFQNDHRMTATGRHIRSPAAAAAAAASFADPWKSISRE
Download sequence
Identical sequences E2BDL0
Hsal_06822--NP_001011614.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]