SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2RP26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RP26
Domain Number 1 Region: 22-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1328-1440
Classification Level Classification E-value
Superfamily E set domains 7.34e-36
Family Filamin repeat (rod domain) 0.000019
Further Details:      
 
Domain Number 3 Region: 1518-1636
Classification Level Classification E-value
Superfamily E set domains 4.47e-35
Family Filamin repeat (rod domain) 0.00000286
Further Details:      
 
Domain Number 4 Region: 1442-1551
Classification Level Classification E-value
Superfamily E set domains 2.67e-32
Family Filamin repeat (rod domain) 0.000019
Further Details:      
 
Domain Number 5 Region: 452-569
Classification Level Classification E-value
Superfamily E set domains 1.47e-31
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 6 Region: 1849-1944
Classification Level Classification E-value
Superfamily E set domains 7.34e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 1143-1248
Classification Level Classification E-value
Superfamily E set domains 2.2e-30
Family Filamin repeat (rod domain) 0.000048
Further Details:      
 
Domain Number 8 Region: 2032-2127
Classification Level Classification E-value
Superfamily E set domains 2.25e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 9 Region: 1061-1152
Classification Level Classification E-value
Superfamily E set domains 7.34e-30
Family Filamin repeat (rod domain) 0.00000956
Further Details:      
 
Domain Number 10 Region: 1239-1349
Classification Level Classification E-value
Superfamily E set domains 1.13e-29
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 11 Region: 668-764
Classification Level Classification E-value
Superfamily E set domains 1e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 12 Region: 752-866
Classification Level Classification E-value
Superfamily E set domains 4.34e-28
Family Filamin repeat (rod domain) 0.00083
Further Details:      
 
Domain Number 13 Region: 856-967
Classification Level Classification E-value
Superfamily E set domains 1.67e-27
Family Filamin repeat (rod domain) 0.00059
Further Details:      
 
Domain Number 14 Region: 2307-2398
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 15 Region: 2629-2719
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000328
Further Details:      
 
Domain Number 16 Region: 374-474
Classification Level Classification E-value
Superfamily E set domains 6.67e-26
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 17 Region: 274-370
Classification Level Classification E-value
Superfamily E set domains 1e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 18 Region: 1625-1738
Classification Level Classification E-value
Superfamily E set domains 1.13e-25
Family Filamin repeat (rod domain) 0.0000589
Further Details:      
 
Domain Number 19 Region: 560-661
Classification Level Classification E-value
Superfamily E set domains 1.67e-25
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 20 Region: 2498-2590
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00000308
Further Details:      
 
Domain Number 21 Region: 2405-2495
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 954-1055
Classification Level Classification E-value
Superfamily E set domains 3e-23
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 23 Region: 2240-2321
Classification Level Classification E-value
Superfamily E set domains 7.34e-20
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 24 Region: 1952-2048
Classification Level Classification E-value
Superfamily E set domains 5.94e-18
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 25 Region: 1786-1866
Classification Level Classification E-value
Superfamily E set domains 6.67e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RP26
Sequence length 2720
Comment (tr|E2RP26|E2RP26_CANLF) Filamin C {ECO:0000313|Ensembl:ENSCAFP00000002323} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FLNC OC=Canis.
Sequence
MMNNSGYSEAAGLGLADEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPMGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGTQKVRAWGPGLKTGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLNLYAQDADGCPVNIMVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKVEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGS
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKANHFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVLDNGGG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMP
HVEEPADVLQLPRPSTYPTHWATEEPVVPAEPMESMLRPFNLVIPFTVQKGELTGEVRMP
SGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAY
GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGD
YSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPS
GNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVR
VWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEP
GTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWF
QMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDF
LGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGP
HTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS
DDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHT
IRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSE
FIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVG
SPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGL
SQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYI
LIVKWGDESVPGSPFKVNVP
Download sequence
Identical sequences E2RP26
XP_539385.1.84170 ENSCAFP00000002323 ENSCAFP00000002323 9615.ENSCAFP00000002323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]