SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2RRF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RRF8
Domain Number 1 Region: 96-232
Classification Level Classification E-value
Superfamily dUTPase-like 1.18e-48
Family dUTPase-like 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RRF8
Sequence length 237
Comment (tr|E2RRF8|E2RRF8_CANLF) Deoxyuridine triphosphatase {ECO:0000313|Ensembl:ENSCAFP00000021075} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=DUT OC=Canis.
Sequence
MTPLCPRPALGSLSSTSWLRSVFKDARGAAPRGEAAGPLFRPLSSTRRPSRGGCRASNVG
RLAERGEAGSAAAAPRAARATPAISPSKRARPAEDGMRLRFVRLSEHATAPTKGSPRAAG
YDLYSAYDYILPPMEKAIVKTDIQVALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRG
NVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFGSTGKN
Download sequence
Identical sequences E2RRF8
ENSCAFP00000021075 ENSCAFP00000021075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]