SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2RRQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RRQ1
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.69e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RRQ1
Sequence length 780
Comment (tr|E2RRQ1|E2RRQ1_CANLF) Solute carrier family 26 member 4 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SLC26A4 OC=Canis.
Sequence
MDAPRSRLEPPPLPEYSCSYVVSRPVFSELAFQQQHERRLQERKTLRESLARGCSCSRKR
GLGVLKTLLPILDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFHTSSGNGTAFNATVIDYAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLIEIFQNVGNTNLADFIAGLLTIIICMAVKEVNDRFKHKIPVPI
PIEVIVTIIATAISYAANLEKNYNAGIVKSIPRGFLPPVLPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYAIKYDYAIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIASIILGLDLGLLAGLMFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTTNYKNIE
ELEGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIIRDAGSSNDAFEPDEDTEDPEDPDVPTKEIEIRVDWNSELPVKMNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFASLQDHVIEKLEKCGFFNDNIRKDIFFL
TVHDAVLHLQNQVKSREVQDSILETITLIQDCKDPLELMEAELIEEELDVQDEAMRSLAS
Download sequence
Identical sequences E2RRQ1
ENSCAFP00000005810 9615.ENSCAFP00000005810 ENSCAFP00000005810 XP_005631003.1.84170 XP_540382.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]