SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3H9Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3H9Y6
Domain Number 1 Region: 9-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-51
Family PP-loop ATPase 0.0000441
Further Details:      
 
Domain Number 2 Region: 362-435
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.73e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 218-310
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000102
Family MesJ substrate recognition domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3H9Y6
Sequence length 446
Comment (tr|E3H9Y6|E3H9Y6_ILYPC) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=572544 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1). GN=Ilyop_1334 OC=Bacteria; Fusobacteria; Fusobacteriales; Fusobacteriaceae; Ilyobacter.
Sequence
MEVIERVREFVLRNDLVGSGEKILLGFSGGPDSVFLFEALLDLKEEFKLEIAIAHINHLL
RGDESDGDEEFCRQLAEKNGIKYYVKKADIKKYSRQHGIGEEEAGRSIRYDFFYKISKEW
GADKVALAHNKDDQVETFLFRMMRGTSLEGLEGIPVRRDIFIRPLSEVYKKDILGYLDSN
KIEYRIDSSNLENTYTRNSIRLDLIPFIEDKYNANFKEKIFSLIEEIKEANKLLKVNISD
YIENEKLDLKKLEELHEYQKRKVINEFLKKYKIEITREKLENILDILKKGGSKKLSLGKN
IVLKKEYDKISVKSKETDSNVLKDVLLKIPGEVKYGNYRIKAFRDINNSVGKNEFCTNLQ
EGMELLIRKRKSGDRIQPVGMNSSKKIKDIFINEKIPKEAREVIPILVLNDEIVWIASVR
GNEKFKSVKSEKIIVKLSVEEDNFSE
Download sequence
Identical sequences E3H9Y6
WP_013387781.1.36262 gi|310779129|ref|YP_003967462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]