SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3HSB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3HSB4
Domain Number 1 Region: 157-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.62e-71
Family Methylesterase CheB, C-terminal domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.41e-28
Family CheY-related 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3HSB4
Sequence length 352
Comment (tr|E3HSB4|E3HSB4_ACHXA) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=762376 OS=Achromobacter xylosoxidans (strain A8). GN=AXYL_02740 OC=Alcaligenaceae; Achromobacter.
Sequence
MKKISVLCVDDSALVRGLMTEIINSQPDMEVVATAPDPLVARELIKRHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLLEYT
EIIADKIRAASRAKLRAPAAHAAPAAPAPMLRRPLSSSEKLVIVGASTGGTEAIREVLQP
LPPDSPAILITQHMPAGFTRSFAQRLDALCAVTVREAVHGDRVLPGHVYLAPGGDMHMRL
GRSGANYVIELEASEPVNRHRPSVDVLFNSAAVAAGKNAIGVILTGMGKDGAAGMLAMHR
AGAHTIAQDEASCVVFGMPREAIALGAADEVVSLSAISERILTRLGDRGHRV
Download sequence
Identical sequences A0A0M7KIB5 E3HSB4
WP_013393378.1.51351 WP_013393378.1.79376 gi|311105922|ref|YP_003978775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]