SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3I0X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3I0X9
Domain Number 1 Region: 5-155
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.62e-32
Family Deoxycytidylate deaminase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3I0X9
Sequence length 212
Comment (tr|E3I0X9|E3I0X9_RHOVT) CMP/dCMP deaminase zinc-binding protein {ECO:0000313|EMBL:ADP72302.1} KW=Complete proteome; Reference proteome OX=648757 OS=LMG 4299). GN=Rvan_3100 OC=Hyphomicrobiaceae; Rhodomicrobium.
Sequence
MAWWNAADEAMMLRCIELSREATREGDYPFGALIALDGEIVAEAGNRAMRDADFSRHAEI
IAIAAALKTVGRGGLARATLYSTVEPCAMCSFCIREAWVGRVAYALASPAMGGVSKWTIL
HDADLGRQLPIFGPAPEVVSGLLAGEALAAWREWNPAATELARLRGALTDETAQQDEPRH
LPAHARSMAQRVVLPFLRLAAWREKHAQLSDR
Download sequence
Identical sequences E3I0X9
gi|312115805|ref|YP_004013401.1| WP_013420669.1.77764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]