SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3KQF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3KQF7
Domain Number 1 Region: 64-303
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.23e-65
Family Alanine racemase-like, N-terminal domain 0.000000238
Further Details:      
 
Domain Number 2 Region: 442-506
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.86e-16
Family Eukaryotic ODC-like 0.00075
Further Details:      
 
Domain Number 3 Region: 283-368
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000154
Family Eukaryotic ODC-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3KQF7
Sequence length 525
Comment (tr|E3KQF7|E3KQF7_PUCGT) Uncharacterized protein {ECO:0000313|EMBL:EFP86532.1} KW=Complete proteome; Reference proteome OX=418459 OS=(Black stem rust fungus). GN=PGTG_12488 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MNGFPPRSSERRKTISVNDHHPIVTEQQQDPLPSIHSNPTINVFRSILTEIDTSKCEENG
ENAFYVCDLAYVYRQYLRWQEALGNRVEPFFAVKCNPDSLVLKLLAQLGTGFDCASHAEI
EMVLKLGVEPSRIIYANPCKAGSFVRHAHAKGVQMMTFDNQDELEKVAKFHPNARMVLRI
LTDDSGSLCRLGEKFGAPLENVRGLLERAKELDVAVIGVAFHVGSGCSNPLLYTDAVGRA
KWTFELGQELGFHFDFLDVGGGFGDDNFDLLAEGLLVGLDKYFPVGCGVRVIAEPGRYFV
TRAFELATNIIARRKAPTPPPSSLVAVTADEQADDLASKDQQDSPVTMYYINDGVYGAFN
CIIFDHQVVEPKVLTLGGVFYGDGFTETGYPSGPMTPCLSEHEMDCSTDSVGSLSVTSAL
FERPIGRLGSSGSGSSAFLVDELELCKIFGPSCDSIDLVSPATLLPTNRLLVGDWLRWPN
MGAYTICAASQFNGFKISQVVYTIGDPSVDEKVRHILRSSSSSAL
Download sequence
Identical sequences E3KQF7
XP_003330951.1.73186 PGTT_12488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]