SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3MFT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3MFT3
Domain Number 1 Region: 388-608
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.82e-61
Family Reverse transcriptase 0.004
Further Details:      
 
Domain Number 2 Region: 788-942
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.41e-41
Family Retroviral integrase, catalytic domain 0.004
Further Details:      
 
Weak hits

Sequence:  E3MFT3
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000502
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3MFT3
Sequence length 1100
Comment (tr|E3MFT3|E3MFT3_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFP01211.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_24401 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSFSVERTKKGSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AACQGNERQSEVLIEPVKKYCHELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENGNKAQDELALLQDAWNEERATLFRELNKLKEEKRLAEEAVSKYKKTL
KGEREASSELRGLLRKQESEPKKAGQVRDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQI
EIPMVVRGRKSAPGISPIMILADGLEEMEKCSFLMEEIKFLGFIINKQGRRPDPEKVRHI
KNMPEPTNVSQVKSFLGLIQFYGQFVKQLFRLRQPLDNLTAKDTDFKWNRECQKSFDTIK
EILQSDLLLTHYNPNLPIIVAADASQYGIGATISHRCPDGTEKTIYHISKTLSKTQRNYS
QIEKEGFGLITAVTKFHKFIHGRKFTLRTDHKPLLTIFGGKKGVPVYTANRLQRWATILL
NYDFDIEYINTKDFGQVDALSRLIDEQNAEKAPEDFVIAQVELDPVDQLPQNLSFLPITA
KTISFQTGKDTLLTDVLNSLKSGKWPKSEKGTEMWNMCNRKDEFSIVNDCIVLGERVVIP
TVLRQKVLKTLHRAHPGIVRMKMLARSYVYWPGIDKDIEKLVKSCDECASAAKNPVKNLL
YSWPIPKKPFERVHVDFAGPVDGMYYLVFVDSLSKWPEVYATTSTTTAATIKILAKVFGQ
FGNPETLVTDNGPQFTSQTFQEFTASNGITHVRTPPYHPQSNGQAERFVDTLKRALCKLR
GEGNTETALQTFLQVYRSTPCASVPNNQSPAEAFIGRKMRTVLNLLLPHKPTPSLKRNLA
METQFNLHHGARDRSFEINDQVYVIDRRSPNSSQWVSGVIERKLGQTVYKVRVGSQRWTR
HANQLRQRTSPPSHYDWSDFLEIEDPAEEMPKPDKADTTTIPVLSPSTSIPPTTPVPLRR
STRNIKPVQPFQIQPKQKRY
Download sequence
Identical sequences E3MFT3
31234.CRE24401 XP_003104937.1.11157 CRE24401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]