SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3NBN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E3NBN5
Domain Number - Region: 333-367
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 9-94
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0034
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3NBN5
Sequence length 466
Comment (tr|E3NBN5|E3NBN5_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFO92062.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_13091 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSSAVESSPTIRKWPPRRTALMATIVAFGSSFSFGFQLLITNPAQGAFIKFLNASKHSNN
PADNVLAHLENEWSLIVAIFFLGSATGAFLIRTVAESTERIKERSSSVTSSEKSWAVQTN
EVRLKERRKLVKGFTDFLESSGRMESDMYEALKAACKGNEGQSEVLVEPVEKYCQELRER
FEELGGERWPLEIIGVMRENGVETVEELRELCEKGVEMVPGGIVENANKAQDELALLQDS
WNEERETLFRELNKLKEEKRLAEEAVSKYKKTLKEEREASSELRGLLRKQENEPKKAGQA
RDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRRGDRKTVGERRDSGAKMKCFTCGGIGHG
SWQCVSKRVDKVQIQEGTVKNAGVETVEMVEMLGQRRRVVIDSGAVVSVISTTAYERLKA
GCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQIKIPLVVRGXXXXE
Download sequence
Identical sequences E3NBN5
XP_003094188.1.11157 31234.CRE13091 CRE13091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]