SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3NEM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3NEM2
Domain Number 1 Region: 131-345
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.89e-25
Family Reverse transcriptase 0.013
Further Details:      
 
Weak hits

Sequence:  E3NEM2
Domain Number - Region: 606-634
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00227
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 
Domain Number - Region: 401-490
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0173
Family FCH domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3NEM2
Sequence length 686
Comment (tr|E3NEM2|E3NEM2_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFO94693.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_08556 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTHFSLTITLPSGILLLNTKFGYTTMGRKKTSRDRSNVNSVMIINSIQEDEPFEYLQKQD
VLKCNGDEFAGSSAEERKEKDKQILQFFRDTVQKRIEGYFVKLPLKTNKIATLPDNYRLT
LKRLIGIVKTTPLEVKKMIQEIFEDQVKKNILEIVTAQTPKGEWTHYSPIQPVLTPHKAT
TKCRVVVDASAHYKGNDSLNDAIEQGPTLLPDILDILIRFRSGETVILADVEKAFLQVRL
NEEDRDLTRILWIKDINLPATPDNVEVYRFTRVLFGLNASPFLLAATIMLHLENHANSKL
ASKINENLYVDNLIFTFDGSAREALELYKEFKAIFADANMNLREDIGNSMCPIQDPMDIQ
EILRAASTIKKHAKILEKIENEKAADKGKEIEIHLAPKWGIDPTKSTLDEMEQFIAQLKE
EGAEFQKDLESAKEEEKVAHQKYVTHLDTSKMKKIENLTVKRAEELNKESDELEKQVNMA
NAVIGDIEAMIGFKNDVLKLVEKWTRNATFEFHRTGKKPDESHAQFLARTQGGEVPQVEK
DPRTEKAIKTTQRQERDLKDRTADPMEHKHTLQSVVSKPTKRPAPSREIKMNEIKRQRKI
RRITSFGEDKPNMKCSFCGGGHFSNQCPQHPSIADRKEIVKRDRLCEHCLLVKTKEPCGC
KERTCYYCETTNHHSALCSLPQTIID
Download sequence
Identical sequences E3NEM2
CRE08556 XP_003093155.1.11157 31234.CRE08556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]